Hemoglobin HbF (α2γ2) Label:[U-15N] labelled
$1895.00
Description
Hemoglobin HbF (α2γ2) Label:[U-15N] labelledInfos bearbeiten unter Weitere Aktionen > Edit Variant Description Folgende Struktur muss bestehen bleiben (relevant fr Tab Layout): Overview Sequence Information Product Information Background Information Download
MSDRGIPKSFRHMDGFGSHTFSLINAKGERFWVKFHFHTMQGVKHLTNEEAAEVRKYDPD
nucleocapsid Protein
Species: Tobaco Etch Virus / artificial
blueTEV contains a His-Tag to facilitate the removal of the protease from the cleavage reaction after completion of cleavage
Compared to the previously circulating variants
1 (Brazil)
Highly accurate protein structure prediction with AlphaFold
trimer) were compared using Sandwich-ELISA based on coating with hACE2 (Cat# P2020-016
which is expressed on activated T cells
greenTEV represents the catalytic domain of the nuclear inclusion a (NIa) protein with a molecular weight of 27 kDa encoded by the plant virus Tobacco Etch Virus
Application: Functional Assay
PPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.