Interleukin-13 receptor subunit alpha-1, Fc/His-tag Species_Pseudomonas aerigunosa In response to helminthic infections

In response to helminthic infections and allergic reactions

1NM_001288614

DSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAG

activin A is involved in hematopoesis as well as in carcinogenesis

Interleukin-13 receptor subunit alpha-1, Fc/His-tag Species_Pseudomonas aerigunosa In response to helminthic infectionsInterleukin 13 Receptor alpha 1 (IL13RA1) is part of the interleukin 13 (IL 13) receptor complex expressed on the surface of various cells, including immune cells, epithelial cells, and fibroblasts. Cytokine induced signaling via IL13RA1 promotes T helper 2 (Th2) mediated immunes responses, including eradication of helminths, regulation of inflammation as well as tissue remodeling and repair. Furthermore, IL13RA1 is associated with a variety of