SARS-CoV-2 (COVID-19) 3CL-Mpro Protein, Tag-free Tags_MBP-Fusion

SARS-CoV-2 (COVID-19) 3CL-Mpro Protein, Tag-free Tags_MBP-FusionThe cysteine protease 3CL Mpro of SARS CoV 2 (COVID 19) cleaves the transcribed viral polyprotein at two self cleavage sites. Here, the polyprotein is cleaved into several functional proteins by the 3CL M protease. Overview Product Name: SARS CoV 2 (COVID 19) 3CL Mpro Protein, Tag free Catalog No.: P2020 019 RefSeq Links: NC_045512. 2; MN908947. 3; YP_009724390. 1; QHD43416. 1; GeneID: 43740568; UniProt: P0DTD1 Synonyms: 3CL Mpro; 3CL Pro; 3CL

Alpha1-proteinase inhibitor (human)

which effectively blocks the IL-4R alpha subunit and thereby the biological effects of IL-4 and IL-13

that contains two cleavage sites to build up the viral replicase complex

lyophilized formulation

Interleukin-6 (IL-6) is an important pro-inflammatory cytokine

1152/ajpheart

to drive differentiation of stem cells into hepatocytes and pancreatic cells

Sequence without tags (AA 18-270):YGPPSSHSSSR_VVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGGSLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARLPVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVSAFGCNFIWKPTVFTRVSAFIDWIEETIASHV

Activation of IL-1 beta is tightly regulated as it is first produced as inactive precursor in response to infection or cell injury and has to be proteolytically cleaved by caspase-1

1NM_000589

Elastase-3B

C-terminal Strep- and His-Tag removed